General Information

  • ID:  hor002667
  • Uniprot ID:  G3MU46
  • Protein name:  NLP-38
  • Gene name:  nlp-38
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  animal
  • Expression:  Expressed in the ventral and dorsal nerve cords and ventral nerve cord motor neurons .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0006935 chemotaxis; GO:0007218 neuropeptide signaling pathway; GO:0007610 behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TPQNWNKLNSLWG
  • Length:  13(49-61)
  • Propeptide:  MQLIHFIVGLAMLISLSLAASDDRVLGWNKAHGLWGKRSVQEASQDKRTPQNWNKLNSLWGKRSASSFDDDYTTENGDDDVTMLYKRSNLSPRFLGRMTFARIPKISPAQWQRANGLWGR
  • Signal peptide:  MQLIHFIVGLAMLISLSLA
  • Modification:  T12 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in several types of aversive gustatory associative learning including gustatory plasticity and salt avoidance learning.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-G3MU46-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002667_AF2.pdbhor002667_ESM.pdb

Physical Information

Mass: 177195 Formula: C71H104N20O20
Absent amino acids: ACDEFHIMRVY Common amino acids: N
pI: 9.7 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: -120 Boman Index: -2154
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60
Instability Index: 4679.23 Extinction Coefficient cystines: 11000
Absorbance 280nm: 916.67

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.